Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowertropicalmeadowinsects
Orchids from Orchid
Black Orchid from Orchid
Anethum graveolens or Dill from Herb
Hemerocallis Spp or Day Lily from Perennial
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Caterpillar and Buttefly from Caterpillar
Flower Poppy from Red
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Europeana Floribunda Rose from Roses
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Orchid Lycaste Aromatica from Orchid
Pollinators of Alaska from Nps
Iris Motif from Iris
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Flower Blossom from Iris
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Double Delight Hybrid Tea Rose from Roses
Black Elderberry from Elderberry
Cosmos Scabiosoides from Cosmos
Steampunk Bee from Steampunk animals coloring book
Bee from Cartoon animals v coloring book
Apple Blossom Branch from Apple tree
Daffodil from Daffodil
Butterfly from Cartoon animals viii coloring book
Swallow Tail Hummingbird from Hummingbirds
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Bumblebee from Woodland animals
Bee from Cartoon animals viii coloring book
Heliconia Indica from Heliconia
Common Fruit Bats from Realistic animals coloring book
Spring Crocus from Crocus
Black Raspberry from Celebrating wildflowers coloring book
Bug from Animals
Hibiscus Flower from Hawaii flower
Cherokee Rose from Roses
Chinese Peony from Flowers
Butterfly from Cartoon animals vii coloring book
Hibiscus from Realistic flowers
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Realistic Sunflowers from Sunflower
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals viii coloring book
Bumblebee from Simple objects coloring book
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Hummingbird from Cartoon animals ii coloring book
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Schlumbergera Bloom from Cactus
Clarkia Amoena Farewell to Spring from Godetia
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Viola Adunca or Pale Mountain Violet from Violet
Daffodil Flowers from Daffodil
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Oriental poppy from Perennial
Grasshopper on Flower from Grasshoppers
Tropical Vanda Tricolor Orchid from Orchid
Aster 1 from Asters
Grasshopper in Garden from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Sundowner Rosa Grandiflora from Roses
Sophronitis Cernua Orchid from Orchid
Cornflower from Cornflowers
Common Evening Primrose or Evening Star from Primrose
Heliconia Psittacorum from Heliconia
Bluebell Bellflower from Bellflower
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Cornflower, Blue Bottle from Cornflowers
Ranunculus Acris from Buttercup
Burke's Larkspur from Celebrating wildflowers coloring book
Scarlet Carnation from Carnation
Butterfly Flies On A Flower from Flowers
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Big-Headed Clover from Celebrating wildflowers coloring book
Life Cycle of Monarch Butterfly from Biology
Pink Hibiscus from Realistic flowers
Black Locust from Locust tree
Chrysanthemum Morifolium from Flower garden
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Chrysanthemum Carinatum from Realistic flowers
Daffodil from Daffodil
Anemone Coronaria from Anemone
Blooming Sunflower from Sunflower
Wildflower from Plants ii coloring book
201 - 300 of 1,830 Next page
/ 19